PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00883.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 335aa    MW: 37951.2 Da    PI: 4.8999
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00883.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.92.1e-49201452128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                               pGf+F+Ptd el+++yLk+k++g + ++ evi+e+diy++ePwdLp k++ ++++ew+fF+ r kky++g++++ratk gyWkat
  Rsa1.0_00883.1_g00010.1  20 FPGFKFSPTDVELISYYLKRKMDGLERSV-EVIPETDIYNFEPWDLPdKSIVKSDTEWFFFCARGKKYPHGSQNRRATKMGYWKAT 104
                              69************************999.99***************778888999****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gk+++v+s ++e++g+k+tLvf+ grapkge+t+W+mhey++
  Rsa1.0_00883.1_g00010.1 105 GKERDVKS-SSEVIGTKRTLVFHIGRAPKGERTEWIMHEYSM 145
                              ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5315161IPR003441NAC domain
PROSITE profilePS5100551.89719162IPR003441NAC domain
PfamPF023654.3E-2521144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEVEPVGGVS KDTVEASTVF PGFKFSPTDV ELISYYLKRK MDGLERSVEV IPETDIYNFE  60
PWDLPDKSIV KSDTEWFFFC ARGKKYPHGS QNRRATKMGY WKATGKERDV KSSSEVIGTK  120
RTLVFHIGRA PKGERTEWIM HEYSMKGVSL DDALVVCRLR RNMEFHKAPE PNLAADKHMI  180
LTDDPVSSGS PYDWDSMVDF YLAGESSENL LTEMAETSRN VQVHTDEDLF ADMLSDEIIN  240
LDEMVMTGNT PNEVPTLESA SSAIRVLPLP NMIDRQMASL VEEIPPQKKK GKDNSGTEPL  300
SSCFVGLYHI KTVNRARWDV IIFVVVLLAL LFHLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-411216313169NAC domain-containing protein 19
3swm_B2e-411216313169NAC domain-containing protein 19
3swm_C2e-411216313169NAC domain-containing protein 19
3swm_D2e-411216313169NAC domain-containing protein 19
3swp_A2e-411216313169NAC domain-containing protein 19
3swp_B2e-411216313169NAC domain-containing protein 19
3swp_C2e-411216313169NAC domain-containing protein 19
3swp_D2e-411216313169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626921.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_013715951.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ94F580.0NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A078C2B40.0A0A078C2B4_BRANA; BnaC03g10790D protein
TrEMBLA0A0D3B2A20.0A0A0D3B2A2_BRAOL; Uncharacterized protein
STRINGBra006619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.10.0NAC domain containing protein 89